Upholstery marine fabric suppliers. Find the perfect marine fabric at Sailrite.
Upholstery marine fabric suppliers Durable, fade resistant, stain resistant, and easy to clean, Sunbrella fabrics stand up to life on the water–and the mold, mildew, and salt residue that come with it. Resource. A detailed marine canvas & awning catalog filled with color charts & specifications, as well as related accessories and hardware. Brands include: Nautolex, Sattler, Stamoid, Sunbrella, Top Gun, Top Notch, WeatherMAX and more. 40 kg Net weight: 0. Since 1868, DLT is the nation's largest stocking supplier of fabric, vinyl, canvas, tools, hardware, and supplies for the commercial, automotive, marine, awning, and contract markets. 29 FABRIC Polyfor * Superior Marine Fabric OFF WHITE colour 100% Polyester 420 gr/m2 Packing Info Gross weight: 0. Experience the perfect blend of resilience and style as our fabrics withstand marine environments while adding aesthetic appeal to your boat interiors. We offer FREE SHIPPING on ALL ORDERS over $150! Taupe Brown Marine Vinyl Fabric | ALG-7064 | Spradling Softside ALLEGRO | Upholstery Vinyl for Boats / Automotive / Commercial Seating | 54"W | BTY 59 Yards In Stock AS LOW AS $18. Explore a wide selection of marine upholstery fabric, sailcloth, canvas, headliner, topping vinyl and more. . Marine fabrics sold by the yard are in stock and ready to ship. Discover our extensive collection of marine fabrics, available by the yard for all your marine upholstery needs. Find the perfect marine fabric at Sailrite. 35 kg Packing size: 26 x 25 x 3 cm Pieces per Compare this product Remove from comparison tool Distributor of the world’s leading range of marine cover and upholstery fabric. Sunbrella marine upholstery fabrics carry the same legendary performance boat enthusiasts have trusted for over 50 years. qbksffyekhrifsachrsnmwfemgwiviwhbwlkewzowfjqnn